Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARL13A Peptide - C-terminal region

ARL13A Peptide - C-terminal region

Product Specifications

UniProt

Q5H913

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARL13A Rabbit Polyclonal Antibody (orb326933) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TCQLPPTSSISISKNNTGSGERCSSHSFSTRTGMSKEKRQHLEQCSIEAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ADIG activation kit by CRISPRa
GA115721 1 Kit

Human ADIG activation kit by CRISPRa

Sign In for Pricing
View Details
MSH2 Antibody
OC-131-01 50 μL

MSH2 Antibody

Sign In for Pricing
View Details
MSH2 Antibody
OC-131-02 100 µL

MSH2 Antibody

Sign In for Pricing
View Details
MSH2 Antibody
OC-131-03 1 mL

MSH2 Antibody

Sign In for Pricing
View Details
MICB Mouse Monoclonal Antibody [Clone ID: B-D54]
AM31285AF-N 200 µg

MICB Mouse Monoclonal Antibody [Clone ID: B-D54]

Sign In for Pricing
View Details
Fascin-1 (FSCN1/418), CF594 conjugate, 0.1mg/mL
BNC940418-500 1x 500 µL

Fascin-1 (FSCN1/418), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details