Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANKRD20A8P Peptide - C-terminal region

ANKRD20A8P Peptide - C-terminal region

Product Specifications

UniProt

Q5CZ79

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANKRD20A8P Rabbit Polyclonal Antibody (orb587317) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IESGKKDLVLEEKSKKLMNECDHLKESLFQYEREKAEGVVSIKEDKYFQT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eukaryotic Factor Related Apoptosis (FAS)
MBS2162472-01 0.01 mg

Eukaryotic Factor Related Apoptosis (FAS)

Sign In for Pricing
View Details
Eukaryotic Factor Related Apoptosis (FAS)
MBS2162472-02 0.05 mg

Eukaryotic Factor Related Apoptosis (FAS)

Sign In for Pricing
View Details
Eukaryotic Factor Related Apoptosis (FAS)
MBS2162472-03 0.1 mg

Eukaryotic Factor Related Apoptosis (FAS)

Sign In for Pricing
View Details
Eukaryotic Factor Related Apoptosis (FAS)
MBS2162472-04 0.2 mg

Eukaryotic Factor Related Apoptosis (FAS)

Sign In for Pricing
View Details
Eukaryotic Factor Related Apoptosis (FAS)
MBS2162472-05 0.5 mg

Eukaryotic Factor Related Apoptosis (FAS)

Sign In for Pricing
View Details
Eukaryotic Factor Related Apoptosis (FAS)
MBS2162472-06 1 mg

Eukaryotic Factor Related Apoptosis (FAS)

Sign In for Pricing
View Details