Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NTN5 Peptide - C-terminal region

NTN5 Peptide - C-terminal region

Product Specifications

UniProt

Q8WTR8

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NTN5 Rabbit Polyclonal Antibody (orb327038) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QCHPIGATGGTCNQTSGQCTCKLGVTGLTCNRCGPGYQQSRSPRMPCQRI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BSCL2/Seipin (D3W8C) Rabbit Monoclonal Antibody
CST 23846T 20 µL

BSCL2/Seipin (D3W8C) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Bovine CaSR ELISA Kit
EBC0544 96 Tests

Bovine CaSR ELISA Kit

Sign In for Pricing
View Details
C-Type Lectin Domain Family 12 Member A (CLEC12A) Antibody
abx320146-01 20 µL

C-Type Lectin Domain Family 12 Member A (CLEC12A) Antibody

Sign In for Pricing
View Details
C-Type Lectin Domain Family 12 Member A (CLEC12A) Antibody
abx320146-02 50 µL

C-Type Lectin Domain Family 12 Member A (CLEC12A) Antibody

Sign In for Pricing
View Details
C-Type Lectin Domain Family 12 Member A (CLEC12A) Antibody
abx320146-03 100 µL

C-Type Lectin Domain Family 12 Member A (CLEC12A) Antibody

Sign In for Pricing
View Details
C-Type Lectin Domain Family 12 Member A (CLEC12A) Antibody
abx320146-04 200 µL

C-Type Lectin Domain Family 12 Member A (CLEC12A) Antibody

Sign In for Pricing
View Details