Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NTN5 Peptide - C-terminal region

NTN5 Peptide - C-terminal region

Product Specifications

UniProt

Q8WTR8

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NTN5 Rabbit Polyclonal Antibody (orb327038) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QCHPIGATGGTCNQTSGQCTCKLGVTGLTCNRCGPGYQQSRSPRMPCQRI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LUCHT450X52CARD-T1-P8 Pipe Markers for Air & Ducts
N004662 2 Card (2 Marker (s) x 1 Card)

LUCHT450X52CARD-T1-P8 Pipe Markers for Air & Ducts

Sign In for Pricing
View Details
Cytochrome P450 2D6 (CYP2D6) Polyclonal Antibody
CAU23441-01 100 µL

Cytochrome P450 2D6 (CYP2D6) Polyclonal Antibody

Sign In for Pricing
View Details
Cytochrome P450 2D6 (CYP2D6) Polyclonal Antibody
CAU23441-02 200 µL

Cytochrome P450 2D6 (CYP2D6) Polyclonal Antibody

Sign In for Pricing
View Details
Cytochrome P450 2D6 (CYP2D6) Polyclonal Antibody
CAU23441-03 1 mL

Cytochrome P450 2D6 (CYP2D6) Polyclonal Antibody

Sign In for Pricing
View Details
APC anti-human CD8a
E16FHA008a-025 25 Tests

APC anti-human CD8a

Sign In for Pricing
View Details
BMP-3
100-394S 10 µg

BMP-3

Sign In for Pricing
View Details