Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5B12 Peptide - C-terminal region

OR5B12 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-241, OR5B12P, OR5B16, OST743

UniProt

Q96R08

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR5B12 Rabbit Polyclonal Antibody (orb587609) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004733

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EMVIFFVVGFNDLFSILVILISYLFIFITIMKMRSPEGRQKAFSTCASHL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human OSBPL5 activation kit by CRISPRa
GA114479 1 Kit

Human OSBPL5 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue Total RNA, Endometrium
CR561516 5 µg

Tissue Total RNA, Endometrium

Sign In for Pricing
View Details
TDG Recombinant Rabbit monoclonal Antibody
HA751531 100 µL

TDG Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Protein A  Colloidal Gold, 1mL 30nm
GP-01-30 1 mL

Protein A Colloidal Gold, 1mL 30nm

Sign In for Pricing
View Details
NHP2L1 (SNU13) (NM_001003796) Human Recombinant Protein
TP321735 20 µg

NHP2L1 (SNU13) (NM_001003796) Human Recombinant Protein

Sign In for Pricing
View Details
Human GPATCH2 activation kit by CRISPRa
GA110517 1 Kit

Human GPATCH2 activation kit by CRISPRa

Sign In for Pricing
View Details