Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5B12 Peptide - C-terminal region

OR5B12 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-241, OR5B12P, OR5B16, OST743

UniProt

Q96R08

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR5B12 Rabbit Polyclonal Antibody (orb587609) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004733

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EMVIFFVVGFNDLFSILVILISYLFIFITIMKMRSPEGRQKAFSTCASHL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GGCX Human Gene Knockout Kit (CRISPR)
KN204003 1 Kit

GGCX Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
10X Chloride -free Stimulus Buffer
7020B 10 mL

10X Chloride -free Stimulus Buffer

Sign In for Pricing
View Details
Oxamyl-d6
TRC-O845142-1MG 1 mg

Oxamyl-d6

Sign In for Pricing
View Details
Recombinant Human SELL Protein (His Tag)
PKSH033351-01 10 µg

Recombinant Human SELL Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human SELL Protein (His Tag)
PKSH033351-02 50 µg

Recombinant Human SELL Protein (His Tag)

Sign In for Pricing
View Details
ZNF74 Human Gene Knockout Kit (CRISPR)
KN401131 1 Kit

ZNF74 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details