Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5K4 Peptide - C-terminal region

OR5K4 Peptide - C-terminal region

Product Specifications

UniProt

A6NMS3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR5K4 Rabbit Polyclonal Antibody (orb587622) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005517

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FLSVSIFYICLLMYIGPSEEGDKDTPVAIFYAIVIPLLNPFIYSLRNKEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MC300E+-ST-OUT-1Y Training Services
323123 1 Pack (1 Piece (s) x 1 Piece)

MC300E+-ST-OUT-1Y Training Services

Sign In for Pricing
View Details
Rnase11 AAV siRNA Pooled Vector
40194164 1.0 µg

Rnase11 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
10 x Bromophenol Blue Loading Dye, 1ml
CSL-LOADDYE 1 m L

10 x Bromophenol Blue Loading Dye, 1ml

Sign In for Pricing
View Details
Acetic Acid 1%
40100317-1 32 oz

Acetic Acid 1%

Sign In for Pricing
View Details
Carm1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3992602 1.0 µg DNA

Carm1 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Scgb3a2, Recombinant, Mouse, aa22-139, His-GST-Tag (Secretoglobin Family 3A Member 2)
375219-01 20 µg

Scgb3a2, Recombinant, Mouse, aa22-139, His-GST-Tag (Secretoglobin Family 3A Member 2)

Sign In for Pricing
View Details