OR5K4 Peptide - C-terminal region
OR5K4 Peptide - C-terminal region
Product Specifications
UniProt
A6NMS3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with OR5K4 Rabbit Polyclonal Antibody (orb587622) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001005517
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FLSVSIFYICLLMYIGPSEEGDKDTPVAIFYAIVIPLLNPFIYSLRNKEV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RR200576L3V 200 µL
Nptx1 (NM_153735) Rat Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 
MBS1321304-01 0.02 mg (E-Coli)
Recombinant Human Vacuolar protein sorting-associated protein 33A (VPS33A)
Sign In for Pricing
View Details MBS1321304-02 0.02 mg (Yeast)
Recombinant Human Vacuolar protein sorting-associated protein 33A (VPS33A)
Sign In for Pricing
View Details MBS1321304-03 0.1 mg (E-Coli)
Recombinant Human Vacuolar protein sorting-associated protein 33A (VPS33A)
Sign In for Pricing
View Details MBS1321304-04 0.1 mg (Yeast)
Recombinant Human Vacuolar protein sorting-associated protein 33A (VPS33A)
Sign In for Pricing
View Details MBS1321304-05 0.02 mg (Baculovirus)
Recombinant Human Vacuolar protein sorting-associated protein 33A (VPS33A)
Sign In for Pricing
View Details