Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR7G2 Peptide - C-terminal region

OR7G2 Peptide - C-terminal region

Product Specifications

UniProt

Q8NG99

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR7G2 Rabbit Polyclonal Antibody (orb587634) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LGVYISSVVTDSPRKTAVASVMYSVFPQMVNPFIYSLRNKDMKGTLRKFI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-Smad2 (Ser250) Polyclonal Antibody, Biotin Conjugated
bs-7464R-Biotin 100 µL

Phospho-Smad2 (Ser250) Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Mouse Monoclonal TREX1 Antibody (41M5F2) [DyLight 755]
NBP2-22394IR 0.1 mL

Mouse Monoclonal TREX1 Antibody (41M5F2) [DyLight 755]

Sign In for Pricing
View Details
CTAGE7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0524408 1.0 µg DNA

CTAGE7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
CYP2E1 polyclonal antibody
orb646571-01 50 μL

CYP2E1 polyclonal antibody

Sign In for Pricing
View Details
CYP2E1 polyclonal antibody
orb646571-02 100 µL

CYP2E1 polyclonal antibody

Sign In for Pricing
View Details
CYP2E1 polyclonal antibody
orb646571-03 200 µL

CYP2E1 polyclonal antibody

Sign In for Pricing
View Details