Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5M10 Peptide - C-terminal region

OR5M10 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-207

UniProt

Q6IEU7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR5M10 Rabbit Polyclonal Antibody (orb587639) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004741

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SAEGRHKAFSTCASHLTIVTLFYGTLFCMYVRPPSEKSVEESKIIAVFYT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SETD2 sgRNA CRISPR Lentivector set (Human)
K2128001 3x 1.0 µg

SETD2 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Rabbit anti-Human AGO3 Polyclonal Antibody
MBS7137637-01 0.05 mL

Rabbit anti-Human AGO3 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-Human AGO3 Polyclonal Antibody
MBS7137637-02 0.1 mL

Rabbit anti-Human AGO3 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-Human AGO3 Polyclonal Antibody
MBS7137637-03 5x 0.1 mL

Rabbit anti-Human AGO3 Polyclonal Antibody

Sign In for Pricing
View Details
DNA, ss Apoptosis BioAssayTM ELISA Kit discontinued
D3878-25 1 Kit

DNA, ss Apoptosis BioAssayTM ELISA Kit discontinued

Sign In for Pricing
View Details
Tubb5 Recombinant Protein (Mouse)
RP182252 100 µg

Tubb5 Recombinant Protein (Mouse)

Sign In for Pricing
View Details