Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5M10 Peptide - C-terminal region

OR5M10 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-207

UniProt

Q6IEU7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR5M10 Rabbit Polyclonal Antibody (orb587639) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004741

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SAEGRHKAFSTCASHLTIVTLFYGTLFCMYVRPPSEKSVEESKIIAVFYT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Ralstonia solanacearum Probable ubiquinone biosynthesis protein UbiB (ubiB)
MBS7032647-01 0.02 mg

Recombinant Ralstonia solanacearum Probable ubiquinone biosynthesis protein UbiB (ubiB)

Sign In for Pricing
View Details
Recombinant Ralstonia solanacearum Probable ubiquinone biosynthesis protein UbiB (ubiB)
MBS7032647-02 0.1 mg

Recombinant Ralstonia solanacearum Probable ubiquinone biosynthesis protein UbiB (ubiB)

Sign In for Pricing
View Details
Recombinant Ralstonia solanacearum Probable ubiquinone biosynthesis protein UbiB (ubiB)
MBS7032647-03 5x 0.1 mg

Recombinant Ralstonia solanacearum Probable ubiquinone biosynthesis protein UbiB (ubiB)

Sign In for Pricing
View Details
ACSF3 Knockout jurkat Polyclonal Cells
ARG33731 1 Million

ACSF3 Knockout jurkat Polyclonal Cells

Sign In for Pricing
View Details
Gm9766 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3330503 1.0 µg DNA

Gm9766 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Bcl G (BCL2L14) (NM_138724) Human Tagged ORF Clone Lentiviral Particle
RC216333L2V 200 µL

Bcl G (BCL2L14) (NM_138724) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details