Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR5P3 Peptide - C-terminal region

OR5P3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

JCG1

UniProt

Q8WZ94

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR5P3 Rabbit Polyclonal Antibody (orb587642) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_703146

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IYVMPKSSYSTDQNKVVSVFYTVVIPMLNPLIYSLRNKEIKGALKRELRI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cd5 3'UTR GFP Stable Cell Line
TU153512 1.0 mL

Cd5 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
beta Enolase protein
MBS5303738-01 0.1 mg

beta Enolase protein

Sign In for Pricing
View Details
beta Enolase protein
MBS5303738-02 5x 0.1 mg

beta Enolase protein

Sign In for Pricing
View Details
PIAS4 Blocking Peptide
MBS9617033-01 1 mg

PIAS4 Blocking Peptide

Sign In for Pricing
View Details
PIAS4 Blocking Peptide
MBS9617033-02 5x 1 mg

PIAS4 Blocking Peptide

Sign In for Pricing
View Details
CHGA Rabbit Polyclonal Antibody (PE-Cy5)
orb2418388 100 µL

CHGA Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details