Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR8H3 Peptide - C-terminal region

OR8H3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-172

UniProt

Q8N146

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR8H3 Rabbit Polyclonal Antibody (orb587650) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005201

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LKPRKSYSLGRDQVAPVFYTIVIPMLNPLIYSLRNREVKNALIRVMQRRQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSK (NM_001127190) Human Recombinant Protein
TP325740L 1 mg

CSK (NM_001127190) Human Recombinant Protein

Sign In for Pricing
View Details
Cadherin like 26 (CDH26) Human Gene Knockout Kit (CRISPR)
KN414867 1 Kit

Cadherin like 26 (CDH26) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GSR Polyclonal Antibody
E-AB-10354-01 20 µL

GSR Polyclonal Antibody

Sign In for Pricing
View Details
GSR Polyclonal Antibody
E-AB-10354-02 60 µL

GSR Polyclonal Antibody

Sign In for Pricing
View Details
GSR Polyclonal Antibody
E-AB-10354-03 120 µL

GSR Polyclonal Antibody

Sign In for Pricing
View Details
GSR Polyclonal Antibody
E-AB-10354-04 200 µL

GSR Polyclonal Antibody

Sign In for Pricing
View Details