Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR8H3 Peptide - C-terminal region

OR8H3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OR11-172

UniProt

Q8N146

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR8H3 Rabbit Polyclonal Antibody (orb587650) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005201

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LKPRKSYSLGRDQVAPVFYTIVIPMLNPLIYSLRNREVKNALIRVMQRRQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Hydroxy Detomidine-15N2,d2 Hydrochloride
TRC-H825342-1MG 1 mg

3-Hydroxy Detomidine-15N2,d2 Hydrochloride

Sign In for Pricing
View Details
NCKX2 (SLC24A2) (NM_001193288) Human Over-expression Lysate
LY433861 100 µg

NCKX2 (SLC24A2) (NM_001193288) Human Over-expression Lysate

Sign In for Pricing
View Details
AF647 Anti-Mouse CD117 Antibody
RD30223F-01 25 µg

AF647 Anti-Mouse CD117 Antibody

Sign In for Pricing
View Details
AF647 Anti-Mouse CD117 Antibody
RD30223F-02 100 µg

AF647 Anti-Mouse CD117 Antibody

Sign In for Pricing
View Details
FAM32A Human Gene Knockout Kit (CRISPR)
KN400334 1 Kit

FAM32A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Siglec-3 / CD33 Protein, Llama IgG2b Fc Tag, low endotoxin
CD3-H5259-1mg 1 mg

Human Siglec-3 / CD33 Protein, Llama IgG2b Fc Tag, low endotoxin

Sign In for Pricing
View Details