Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OTOGL Peptide - N-terminal region

OTOGL Peptide - N-terminal region

Product Specifications

UniProt

E2QRK2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OTOGL Rabbit Polyclonal Antibody (orb327071) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IQYLCEKDDVCVFQEVSVLNPGQSMIKYLEEDFCYAIECLEEKDNHTGFH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CT45A7 (Center) Rabbit Polyclonal Antibody
AP51112PU-N 400 µL

CT45A7 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
9-Bromo Hydrocortisone 21-Acetate
TRC-B684474-50MG 50 mg

9-Bromo Hydrocortisone 21-Acetate

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung: left upper lobe
CS649694 5x 5 µm

Frozen Tissue Sections, Lung: left upper lobe

Sign In for Pricing
View Details
5-Hydroxy Thiabendazole-13C2,15N
TRC-H961202-5MG 5 mg

5-Hydroxy Thiabendazole-13C2,15N

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary
CS702715 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
Lexithromycin
TRC-L397703-5MG 5 mg

Lexithromycin

Sign In for Pricing
View Details