Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OTOGL Peptide - N-terminal region

OTOGL Peptide - N-terminal region

Product Specifications

UniProt

E2QRK2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OTOGL Rabbit Polyclonal Antibody (orb327071) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IQYLCEKDDVCVFQEVSVLNPGQSMIKYLEEDFCYAIECLEEKDNHTGFH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF614 Human Gene Knockout Kit (CRISPR)
KN420077 1 Kit

ZNF614 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IRF8 (C-term) Rabbit Polyclonal Antibody
AP12482PU-N 400 µL

IRF8 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Filaggrin (Keratinocyte Differentiation Marker) (FLG/1561), CF647 conjugate, 0.1mg/mL
BNC471561-100 1x 100 µL

Filaggrin (Keratinocyte Differentiation Marker) (FLG/1561), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
3-Chlorobenzotrichloride
TRC-C367740-100MG 100 mg

3-Chlorobenzotrichloride

Sign In for Pricing
View Details
Mitochondrial Marker (113-1), CF640R conjugate, 0.1mg/mL
BNC400739-100 1x 100 µL

Mitochondrial Marker (113-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HOMER2 Rabbit Polyclonal Antibody
TA369163 100 µL

HOMER2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details