Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDIA5 Peptide - N-terminal region

PDIA5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PDIR

UniProt

Q14554

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDIA5 Rabbit Polyclonal Antibody (orb587700) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006801

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHTEYNRA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ssb Mouse Gene Knockout Kit (CRISPR)
KN516755 1 Kit

Ssb Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RGR (NM_002921) Human Over-expression Lysate
LY419024 100 µg

RGR (NM_002921) Human Over-expression Lysate

Sign In for Pricing
View Details
Fmoc-Cys (Trt) Wang Resin
H0751501306.5G 5 g

Fmoc-Cys (Trt) Wang Resin

Sign In for Pricing
View Details
Myc tag, AlpHcAbs® Rabbit antibody
HA710120 100 µg

Myc tag, AlpHcAbs® Rabbit antibody

Sign In for Pricing
View Details
Recombinant Human VEGF-A/VEGF121 Protein
PKSH033207-01 20 µg

Recombinant Human VEGF-A/VEGF121 Protein

Sign In for Pricing
View Details
Recombinant Human VEGF-A/VEGF121 Protein
PKSH033207-02 100 µg

Recombinant Human VEGF-A/VEGF121 Protein

Sign In for Pricing
View Details