Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDIA5 Peptide - N-terminal region

PDIA5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

PDIR

UniProt

Q14554

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDIA5 Rabbit Polyclonal Antibody (orb587700) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006801

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHTEYNRA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pelargonidin
TRC-P218500-10MG 10 mg

Pelargonidin

Sign In for Pricing
View Details
Txn1 Mouse Gene Knockout Kit (CRISPR)
KN318506 1 Kit

Txn1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Phospholipase A2 (PLB1) Rabbit Polyclonal Antibody
TA380011 100 µL

Phospholipase A2 (PLB1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Sema5b Mouse Gene Knockout Kit (CRISPR)
KN515507 1 Kit

Sema5b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Fascin-1 (FSCN1/417), CF740 conjugate, 0.1mg/mL
BNC740417-500 1x 500 µL

Fascin-1 (FSCN1/417), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SLP76 (LCP2) Human Gene Knockout Kit (CRISPR)
KN204404LP 1 Kit

SLP76 (LCP2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details