Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDZD3 Peptide - N-terminal region

PDZD3 Peptide - N-terminal region

Product Specifications

UniProt

Q86UT5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PDZD3 Rabbit Polyclonal Antibody (orb587701) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PDPWSLERPRFCLLSKEEGKSFGFHLQQELGRAGHVVCRVDPGTSAQRQG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human AZGP1 (Zinc-alpha-2-glycoprotein) ELISA Kit
E-EL-H1541-01 24 Tests

Human AZGP1 (Zinc-alpha-2-glycoprotein) ELISA Kit

Sign In for Pricing
View Details
Human AZGP1 (Zinc-alpha-2-glycoprotein) ELISA Kit
E-EL-H1541-02 48 Tests

Human AZGP1 (Zinc-alpha-2-glycoprotein) ELISA Kit

Sign In for Pricing
View Details
Human AZGP1 (Zinc-alpha-2-glycoprotein) ELISA Kit
E-EL-H1541-03 96 Tests

Human AZGP1 (Zinc-alpha-2-glycoprotein) ELISA Kit

Sign In for Pricing
View Details
Dub2a siRNA Oligos set (Mouse)
18658174 3x 5 nmol

Dub2a siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
GNAS (Guanine Nucleotide Binding Protein G (s) Subunit alpha Isoforms XLas, GNAS1, GPSA, GSA, Adenylate Cyclase Stimulating G alpha Protein, AHO, C20orf45, Extra Large alphas Protein, XLalphas, GSP, MGC33735, NESP, PHP1A, PHP1B, PHP1C, POH) (FITC) discontinued
G8250-22-FITC 200 µL

GNAS (Guanine Nucleotide Binding Protein G (s) Subunit alpha Isoforms XLas, GNAS1, GPSA, GSA, Adenylate Cyclase Stimulating G alpha Protein, AHO, C20orf45, Extra Large alphas Protein, XLalphas, GSP, MGC33735, NESP, PHP1A, PHP1B, PHP1C, POH) (FITC) discontinued

Sign In for Pricing
View Details
Human ZC3HAV1 siRNA
abx940273-01 15 nmol

Human ZC3HAV1 siRNA

Sign In for Pricing
View Details