PDZD3 Peptide - N-terminal region
PDZD3 Peptide - N-terminal region
Product Specifications
UniProt
Q86UT5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PDZD3 Rabbit Polyclonal Antibody (orb587701) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PDPWSLERPRFCLLSKEEGKSFGFHLQQELGRAGHVVCRVDPGTSAQRQG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
SAM1304 500 / PCK
Not for human use Quality Control Ultra Adhesive Labels. Roll of 500 - 95 x 95mm
Sign In for Pricing
View Details 149970 100 µg
TFB1M (Dimethyladenosine Transferase 1, Mitochondrial, Mitochondrial 12S rRNA Dimethylase 1, Mitochondrial Transcription Factor B1, h-mtTFB, h-mtTFB1, hTFB1M, mtTFB1, S-adenosylmethionine-6-N', N'-adenosyl (rRNA) Dimethyltransferase 1, CGI75, CGI-75) discontinued
Sign In for Pricing
View Details 
MBS1335523-01 0.02 mg (E-Coli)
Recombinant Zalerion arboricola Pyrroline-5-carboxylate reductase (P5CR)
Sign In for Pricing
View Details MBS1335523-02 0.02 mg (Yeast)
Recombinant Zalerion arboricola Pyrroline-5-carboxylate reductase (P5CR)
Sign In for Pricing
View Details MBS1335523-03 0.1 mg (E-Coli)
Recombinant Zalerion arboricola Pyrroline-5-carboxylate reductase (P5CR)
Sign In for Pricing
View Details MBS1335523-04 0.1 mg (Yeast)
Recombinant Zalerion arboricola Pyrroline-5-carboxylate reductase (P5CR)
Sign In for Pricing
View Details