GATB Peptide - N-terminal region
GATB Peptide - N-terminal region
Product Specifications
Product Name Alternative
PET112, HSPC199, PET112L
UniProt
O75879
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GATB Rabbit Polyclonal Antibody (orb327076) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_004555
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GSTSNQIRGESSVAQQPLHTAQKTRKGEHKWAAVVGLEIHAQISSNSKLF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040178-500 1x 500 µL
CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040034-100 1x 100 µL
Cytokeratin 8/18 (C-51), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 