PLEKHA5 Peptide - C-terminal region
PLEKHA5 Peptide - C-terminal region
Product Specifications
UniProt
Q9HAU0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PLEKHA5 Rabbit Polyclonal Antibody (orb327079) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ASDQSPLQSPSNLRDNPFRTTQTRRRDDKELDTAIRENDVKPDHETPATE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![VPS13B Mouse Monoclonal Antibody [Clone ID: OTI6F6]](https://cdn.genprice.uk/products/937/68dd18b9061270361e9081a0/imageurl/cf807801.webp)
CF807801 100 µg
VPS13B Mouse Monoclonal Antibody [Clone ID: OTI6F6]
Sign In for Pricing
View Details 
LY403430 100 µg
NAPRT1 (NAPRT) (NM_145201) Human Over-expression Lysate
Sign In for Pricing
View Details 
AP54041PU-N 400 µL
Cortactin (CTTN) (N-term) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
TP307037L 1 mg
Alpha SNAP (NAPA) (NM_003827) Human Recombinant Protein
Sign In for Pricing
View Details