Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLSCR1 Peptide - middle region

PLSCR1 Peptide - middle region

Product Specifications

Product Name Alternative

MMTRA1B

UniProt

O15162

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLSCR1 Rabbit Polyclonal Antibody (orb587708) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_066928

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TGFETNNKYEIKNSFGQRVYFAAEDTDCCTRNCCGPSRPFTLRIIDNMGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human COP (CARD16) activation kit by CRISPRa
GA114443 1 Kit

Human COP (CARD16) activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Bone
CS702414 5x 5 µm

Tissue FFPE Sections, Bone

Sign In for Pricing
View Details
Human PDE12 activation kit by CRISPRa
GA116401 1 Kit

Human PDE12 activation kit by CRISPRa

Sign In for Pricing
View Details
5-Chloro-2-oxindole
TRC-C375030-25G 25 g

5-Chloro-2-oxindole

Sign In for Pricing
View Details
CDX2 / Caudal Type Homeobox 2 (GI Epithelial Marker) (CDX2/2214), CF405S conjugate, 0.1mg/mL
BNC042214-500 1x 500 µL

CDX2 / Caudal Type Homeobox 2 (GI Epithelial Marker) (CDX2/2214), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OPN1MW Human Gene Knockout Kit (CRISPR)
KN419287 1 Kit

OPN1MW Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details