Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLSCR1 Peptide - middle region

PLSCR1 Peptide - middle region

Product Specifications

Product Name Alternative

MMTRA1B

UniProt

O15162

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLSCR1 Rabbit Polyclonal Antibody (orb587708) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_066928

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TGFETNNKYEIKNSFGQRVYFAAEDTDCCTRNCCGPSRPFTLRIIDNMGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Garre1 Mouse Gene Knockout Kit (CRISPR)
KN500414 1 Kit

Garre1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CLTC Rabbit Monoclonal Antibody [Clone ID: 24GB6960]
TA425364 100 µL

CLTC Rabbit Monoclonal Antibody [Clone ID: 24GB6960]

Sign In for Pricing
View Details
N,9-O-Diacetylneuraminic Acid
TRC-D454483-5MG 5 mg

N,9-O-Diacetylneuraminic Acid

Sign In for Pricing
View Details
C5orf24 (NM_001135586) Human Recombinant Protein
TP326792 20 µg

C5orf24 (NM_001135586) Human Recombinant Protein

Sign In for Pricing
View Details
Tuberin (TSC2) pThr1462 Rabbit Polyclonal Antibody
AP20916PU-N 100 µg

Tuberin (TSC2) pThr1462 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human IL-2 protein (His tag)
PDMH100130-01 20 µg

Recombinant Human IL-2 protein (His tag)

Sign In for Pricing
View Details