PRAMEF1 Peptide - N-terminal region
PRAMEF1 Peptide - N-terminal region
Product Specifications
UniProt
O95521
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PRAMEF1 Rabbit Polyclonal Antibody (orb327084) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_075389
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GAWALSCFPETTSKRQTAEDCPRMGEHQPLKVFIDICLKEIPQDECLRYL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC882231-100 1x 100 µL
14-3-3E / Tryptophan 5-Monooxygenase (CPTC-YWHAE-1), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![14-3-3 Recombinant Rabbit Monoclonal Antibody [JJ083-6]](https://cdn.genprice.uk/products/992/68dd1c8a061270361ea80e84/imageurl/et1701-2.webp)
ET1701-2 100 µL
14-3-3 Recombinant Rabbit Monoclonal Antibody [JJ083-6]
Sign In for Pricing
View Details ![EBFP Mouse Monoclonal Antibody [Clone ID: 3A6]](https://cdn.genprice.uk/products/937/68dd189d061270361e8fd21f/imageurl/am32008pu-n.webp)
![NG2 (CSPG4) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5H8]](https://cdn.genprice.uk/products/937/68dd1b87061270361ea20fa7/imageurl/ta812897bm.webp)
TA812897BM 100 µL
NG2 (CSPG4) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5H8]
Sign In for Pricing
View Details 