PRAMEF1 Peptide - N-terminal region
PRAMEF1 Peptide - N-terminal region
Product Specifications
UniProt
O95521
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PRAMEF1 Rabbit Polyclonal Antibody (orb327084) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_075389
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GAWALSCFPETTSKRQTAEDCPRMGEHQPLKVFIDICLKEIPQDECLRYL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BA-1401-1 1 mg
Biotin Conjugated Lens culinaris Lectin (Lentil) -LcH-
Sign In for Pricing
View Details 
BNUB1619-500 1x 500 µL
CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/1619), 0.2mg/mL
Sign In for Pricing
View Details 
