Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRAMEF15 Peptide - C-terminal region

PRAMEF15 Peptide - C-terminal region

Product Specifications

UniProt

Q5VWM5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRAMEF15 Rabbit Polyclonal Antibody (orb327086) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001091846

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SHMDVSRYVSPEQKKEIVTQFTTQFLKLRCLQKLYMNSVSFLEGHLDQLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TFIP11 Human Gene Knockout Kit (CRISPR)
KN400290 1 Kit

TFIP11 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Genomic DNA, Lymph node
CD565167 5 µg

Tissue Genomic DNA, Lymph node

Sign In for Pricing
View Details
Purified Anti-Human/Mouse IL-5 Antibody[TRFK5]
E-AB-F1205A-01 25 µg

Purified Anti-Human/Mouse IL-5 Antibody[TRFK5]

Sign In for Pricing
View Details
Purified Anti-Human/Mouse IL-5 Antibody[TRFK5]
E-AB-F1205A-02 100 µg

Purified Anti-Human/Mouse IL-5 Antibody[TRFK5]

Sign In for Pricing
View Details
Bifendate Dicarboxylic Acid
TRC-B382895-250MG 250 mg

Bifendate Dicarboxylic Acid

Sign In for Pricing
View Details
4-Bromophthalonitrile
TRC-B688153-250MG 250 mg

4-Bromophthalonitrile

Sign In for Pricing
View Details