Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRAMEF15 Peptide - C-terminal region

PRAMEF15 Peptide - C-terminal region

Product Specifications

UniProt

Q5VWM5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRAMEF15 Rabbit Polyclonal Antibody (orb327086) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001091846

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SHMDVSRYVSPEQKKEIVTQFTTQFLKLRCLQKLYMNSVSFLEGHLDQLL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIRT4 (NM_012240) Human Over-expression Lysate
LY402175 100 µg

SIRT4 (NM_012240) Human Over-expression Lysate

Sign In for Pricing
View Details
4,4-Dipropylcyclohex-2-enone
TRC-D492300-2G 2 g

4,4-Dipropylcyclohex-2-enone

Sign In for Pricing
View Details
Slc11a2 Mouse Gene Knockout Kit (CRISPR)
KN315860 1 Kit

Slc11a2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FITC Conjugated Human CD45 Recombinant Mouse Monoclonal Antibody [PSH03-64]
HA600125F 100 µL

FITC Conjugated Human CD45 Recombinant Mouse Monoclonal Antibody [PSH03-64]

Sign In for Pricing
View Details
CHOX_ALCSP Goat Polyclonal Antibody
TA396632S 25 µL

CHOX_ALCSP Goat Polyclonal Antibody

Sign In for Pricing
View Details
Optitrol HIV 2
SR11117 2x 2.5 mL

Optitrol HIV 2

Sign In for Pricing
View Details