PRAMEF17 Peptide - N-terminal region
PRAMEF17 Peptide - N-terminal region
Product Specifications
UniProt
Q5VTA0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PRAMEF17 Rabbit Polyclonal Antibody (orb327087) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001093321
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EAMSKRQTVEDYPRTGEHQPLKVFIDLCQKESTLDECLSYLCRWIHYRRG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
GA109271 1 Kit
Human Cytochrome b c1 complex subunit 9 (UQCR10) activation kit by CRISPRa
Sign In for Pricing
View Details ![SFPQ Rabbit Monoclonal Antibody [Clone ID: 24GB1220]](https://cdn.genprice.uk/products/937/6868c301994c49e6dc3ed143/imageurl/ta425216.webp)
TA425216 100 µL
SFPQ Rabbit Monoclonal Antibody [Clone ID: 24GB1220]
Sign In for Pricing
View Details 