Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRAMEF17 Peptide - N-terminal region

PRAMEF17 Peptide - N-terminal region

Product Specifications

UniProt

Q5VTA0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRAMEF17 Rabbit Polyclonal Antibody (orb327087) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001093321

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EAMSKRQTVEDYPRTGEHQPLKVFIDLCQKESTLDECLSYLCRWIHYRRG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lmntd2 Mouse Gene Knockout Kit (CRISPR)
KN500050 1 Kit

Lmntd2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Histone H2A (phospho S129) Antibody
RC-16623-01 50 μL

Recombinant Histone H2A (phospho S129) Antibody

Sign In for Pricing
View Details
Recombinant Histone H2A (phospho S129) Antibody
RC-16623-02 100 µL

Recombinant Histone H2A (phospho S129) Antibody

Sign In for Pricing
View Details
Recombinant Histone H2A (phospho S129) Antibody
RC-16623-03 1 mL

Recombinant Histone H2A (phospho S129) Antibody

Sign In for Pricing
View Details
8,9-Z-Abamectin B1a
TRC-A107005-5MG 5 mg

8,9-Z-Abamectin B1a

Sign In for Pricing
View Details
Tissue Total RNA, Heart
CR562037 5 µg

Tissue Total RNA, Heart

Sign In for Pricing
View Details