Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRSS37 Peptide - N-terminal region

PRSS37 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TRYX2

UniProt

A4D1T9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRSS37 Rabbit Polyclonal Antibody (orb327090) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001008271

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AGTFFFADSSVQKEDPAPYLVYLKSHFNPCVGVLIKPSWVLAPAHCYLPN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXO15 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
20310111 3x 1.0 µg

FBXO15 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
CBLL1 Recombinant Protein Antigen
NBP1-83589PEP 0.1 mL

CBLL1 Recombinant Protein Antigen

Sign In for Pricing
View Details
Sesamoside
466046-01 1 mg

Sesamoside

Sign In for Pricing
View Details
Sesamoside
466046-02 5 mg

Sesamoside

Sign In for Pricing
View Details
TMBIM1 Protein Vector (Mouse) (pPM-C-HA)
46812024 500 ng

TMBIM1 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Pearl Ladies Safety Trainer Size 7 - PR
SAF3290 PR

Pearl Ladies Safety Trainer Size 7 - PR

Sign In for Pricing
View Details