Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRSS37 Peptide - N-terminal region

PRSS37 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TRYX2

UniProt

A4D1T9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRSS37 Rabbit Polyclonal Antibody (orb327090) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001008271

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AGTFFFADSSVQKEDPAPYLVYLKSHFNPCVGVLIKPSWVLAPAHCYLPN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Annexin A3 MAb (Clone 693510)
MAB4855-SP 25 µg

Human Annexin A3 MAb (Clone 693510)

Sign In for Pricing
View Details
Recombinant human ADRM1 protein
ATGP1498-500 500 µg

Recombinant human ADRM1 protein

Sign In for Pricing
View Details
Human IgA Matched Antibody Pair Set [ABP-S-02105]
ABP-S-02105 5 Plates

Human IgA Matched Antibody Pair Set [ABP-S-02105]

Sign In for Pricing
View Details
GPC4 Protein Lysate (Human) with C-Ha Tag
22449031 100 µg

GPC4 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
DIRC2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
18243061 1.0 µg DNA

DIRC2 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Feline Calicivirus & Herpesvirus & Chlamydophila felis & Mycoplasma felis Real-time PCR
PZ1011 16 Tests

Feline Calicivirus & Herpesvirus & Chlamydophila felis & Mycoplasma felis Real-time PCR

Sign In for Pricing
View Details