Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRSS53 Peptide - N-terminal region

PRSS53 Peptide - N-terminal region

Product Specifications

Product Name Alternative

POL3S, UNQ308

UniProt

Q2L4Q9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRSS53 Rabbit Polyclonal Antibody (orb327094) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001034592

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GATVLMEGLQAAQRACGQRGPGPPKPQEGNTVPGEWPWQASVRRQGAHIC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S1PR3 Polyclonal Antibody, FITC Conjugated
A67156-100 100 µL

S1PR3 Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
MDCK Cell Serum-Free Medium-2 (Powder)
VCum-Lsx0012 1 L

MDCK Cell Serum-Free Medium-2 (Powder)

Sign In for Pricing
View Details
Human MED18 qPCR Primer Pair
QH43077S 200 Tests

Human MED18 qPCR Primer Pair

Sign In for Pricing
View Details
β-Lactamase-IN-2
BA1181-5.1 1 mL (10 mM in DMSO)

β-Lactamase-IN-2

Sign In for Pricing
View Details
Chicken PTX3 (Pentraxin 3, Long) ELISA Kit
EK251341 96 Well

Chicken PTX3 (Pentraxin 3, Long) ELISA Kit

Sign In for Pricing
View Details
Odin Double Nickase Plasmid (h2)
sc-409843-NIC-2 20 µg

Odin Double Nickase Plasmid (h2)

Sign In for Pricing
View Details