PRSS55 Peptide - C-terminal region
PRSS55 Peptide - C-terminal region
Product Specifications
Product Name Alternative
T-SP1, UNQ9391
UniProt
Q6UWB4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PRSS55 Rabbit Polyclonal Antibody (orb587724) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_940866
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SWGKSCGEKNTPGIYTSLVNYNLWIEKVTQLEGRPFNAEKRRTSVKQKPM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-D173940-10MG 10 mg
Alpha-D-Digitoxopyranosyl-oxy 12Beta-Acetyldigoxigenin
Sign In for Pricing
View Details 
NUN-C52Hd-100ug 100 µg
SARS-CoV-2 Nucleocapsid protein (T205I), His Tag
Sign In for Pricing
View Details 
![Caveolin-1 Mouse Monoclonal Antibody [A3E6]](https://cdn.genprice.uk/products/992/68dd1c8e061270361ea82397/imageurl/ha601005.webp)
