PRSS55 Peptide - C-terminal region
PRSS55 Peptide - C-terminal region
Product Specifications
Product Name Alternative
T-SP1, UNQ9391
UniProt
Q6UWB4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PRSS55 Rabbit Polyclonal Antibody (orb587724) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_940866
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SWGKSCGEKNTPGIYTSLVNYNLWIEKVTQLEGRPFNAEKRRTSVKQKPM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC942314-100 1x 100 µL
P40 (deltaNp63) (Squamous, Basal & Myoepithelial Cell Marker), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940788-500 1x 500 µL
MART-1 / Melan-A (MLANA/788), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![FOLR3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6C1]](https://cdn.genprice.uk/products/937/68dd1b85061270361ea2046b/imageurl/ta811551bm.webp)
TA811551BM 100 µL
FOLR3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI6C1]
Sign In for Pricing
View Details 
BNC741474-500 1x 500 µL
ATRX / RAD54 (Alpha Thalassemia Mental Retardation) (23c), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details