PTAR1 Peptide - C-terminal region
PTAR1 Peptide - C-terminal region
Product Specifications
UniProt
Q7Z6K3
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PTAR1 Rabbit Polyclonal Antibody (orb587726) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001093136
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LISQTVIDSSVMEQNPLRSEPALVPPKDEEAAVSTEEPRINLPHLLEEEV
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Carboxypeptidase M (CPM) Mouse Monoclonal Antibody [Clone ID: OTI7C1]](https://cdn.genprice.uk/products/937/68dd18b9061270361e908049/imageurl/cf807285.webp)
CF807285 100 µg
Carboxypeptidase M (CPM) Mouse Monoclonal Antibody [Clone ID: OTI7C1]
Sign In for Pricing
View Details 
BNC041146-100 1x 100 µL
CD86 (C86/1146), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472197-100 1x 100 µL
HCG-beta (Pregnancy & Choriocarcinoma Marker) (rHCGb/54), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881778-100 1x 100 µL
Spectrin beta III (SPTBN2) (SPTBN2/1778), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 