Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTAR1 Peptide - C-terminal region

PTAR1 Peptide - C-terminal region

Product Specifications

UniProt

Q7Z6K3

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PTAR1 Rabbit Polyclonal Antibody (orb587726) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001093136

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LISQTVIDSSVMEQNPLRSEPALVPPKDEEAAVSTEEPRINLPHLLEEEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCA10 Rabbit Polyclonal Antibody
TA368619 100 µL

ABCA10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human PARP16 activation kit by CRISPRa
GA110402 1 Kit

Human PARP16 activation kit by CRISPRa

Sign In for Pricing
View Details
2’-Deoxyadenosine 5’Monophosphate
TRC-D231630-1G 1 g

2’-Deoxyadenosine 5’Monophosphate

Sign In for Pricing
View Details
MRPP3 (KIAA0391) Rabbit Polyclonal Antibody
TA362346 100 µL

MRPP3 (KIAA0391) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
(17Alpha)-19-Norpregn-5-en-20-yne-3,17-diol
TRC-N825100-5MG 5 mg

(17Alpha)-19-Norpregn-5-en-20-yne-3,17-diol

Sign In for Pricing
View Details
6-Fluoronicotinic Acid
TRC-F593683-5G 5 g

6-Fluoronicotinic Acid

Sign In for Pricing
View Details