What is the catalog number for RALGAPB Peptide - C-terminal region?

The catalog number for RALGAPB Peptide - C-terminal region is orb2003694.

What sizes are available for RALGAPB Peptide - C-terminal region?

RALGAPB Peptide - C-terminal region is available in the following size(s): 100 µg.

Is RALGAPB Peptide - C-terminal region in stock?

RALGAPB Peptide - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

RALGAPB Peptide - C-terminal region

Product Specifications

UniProt

Q86X10

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MKPGQKTNQEILKNVESSRTVQPHFLEFLLSLGWSVDVGRHPGWTGHVST

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MBS9146285-01 0.02 mL

[KO Validated] CD68 Rabbit pAb

Sign In for Pricing

View Details

MBS9146285-02 0.1 mL

[KO Validated] CD68 Rabbit pAb

Sign In for Pricing

View Details

MBS9146285-03 5x 0.1 mL

[KO Validated] CD68 Rabbit pAb

Sign In for Pricing

View Details

NBP1-05199JF525 0.1 mL

Rabbit Polyclonal CTR2 Antibody [Janelia Fluor 525]

Sign In for Pricing

View Details

TL308794 1 Kit

SEC62 Human shRNA Plasmid Kit (Locus ID 7095)

Sign In for Pricing

View Details

NBP2-90548AF750 0.1 mL

Rabbit Monoclonal Factor IX Antibody (003) [Alexa Fluor 750]

Sign In for Pricing

View Details