RALGAPB Peptide - C-terminal region
RALGAPB Peptide - C-terminal region
Product Specifications
UniProt
Q86X10
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MKPGQKTNQEILKNVESSRTVQPHFLEFLLSLGWSVDVGRHPGWTGHVST
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
24352111 3x 1.0 µg
IGHD2OR15-2B sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
Sign In for Pricing
View Details 
MBS263028-01 48 Well
Chicken Vascular Endothelial Growth Factor Receptor 3 (VEGFR-3) ELISA Kit
Sign In for Pricing
View Details MBS263028-02 96 Well
Chicken Vascular Endothelial Growth Factor Receptor 3 (VEGFR-3) ELISA Kit
Sign In for Pricing
View Details MBS263028-03 5x 96 Well
Chicken Vascular Endothelial Growth Factor Receptor 3 (VEGFR-3) ELISA Kit
Sign In for Pricing
View Details