Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBM43 Peptide - N-terminal region

RBM43 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C2orf38

UniProt

Q6ZSC3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RBM43 Rabbit Polyclonal Antibody (orb587734) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_940959

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VAYVIFKEKKVAENVIRQKKHWLARKTRHAELTVSLRVSHFGDKIFSSVN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC Anti-Human CD56/NCAM Antibody[MY31]
E-AB-F1270C-01 20 Tests

FITC Anti-Human CD56/NCAM Antibody[MY31]

Sign In for Pricing
View Details
FITC Anti-Human CD56/NCAM Antibody[MY31]
E-AB-F1270C-02 100 Tests

FITC Anti-Human CD56/NCAM Antibody[MY31]

Sign In for Pricing
View Details
FITC Anti-Human CD56/NCAM Antibody[MY31]
E-AB-F1270C-03 2x 100 Tests

FITC Anti-Human CD56/NCAM Antibody[MY31]

Sign In for Pricing
View Details
Cytoplasmic dynein 1 light intermediate chain 1 (DYNC1LI1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H4]
TA501511AM 100 µL

Cytoplasmic dynein 1 light intermediate chain 1 (DYNC1LI1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1H4]

Sign In for Pricing
View Details
General 17-Hydroxyprogesterone (17-OHP) ELISA Kit
RDR-17-OHP-Ge-01 96 Tests

General 17-Hydroxyprogesterone (17-OHP) ELISA Kit

Sign In for Pricing
View Details
General 17-Hydroxyprogesterone (17-OHP) ELISA Kit
RDR-17-OHP-Ge-02 48 Tests

General 17-Hydroxyprogesterone (17-OHP) ELISA Kit

Sign In for Pricing
View Details