Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBM43 Peptide - N-terminal region

RBM43 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C2orf38

UniProt

Q6ZSC3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RBM43 Rabbit Polyclonal Antibody (orb587734) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_940959

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VAYVIFKEKKVAENVIRQKKHWLARKTRHAELTVSLRVSHFGDKIFSSVN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATG7 (NM_001144912) Human Over-expression Lysate
LC428569 20 µg

ATG7 (NM_001144912) Human Over-expression Lysate

Sign In for Pricing
View Details
Sulfamoxole
TRC-S689010-1G 1 g

Sulfamoxole

Sign In for Pricing
View Details
GSK3 beta Recombinant Rabbit monoclonal Antibody
HA750131 100 µL

GSK3 beta Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
2-[(2,6-Dichlorophenyl)amino]benzaldehyde (Diclofenac impurity)
TRC-D435660-25MG 25 mg

2-[(2,6-Dichlorophenyl)amino]benzaldehyde (Diclofenac impurity)

Sign In for Pricing
View Details
9130409I23Rik Mouse Gene Knockout Kit (CRISPR)
KN500513 1 Kit

9130409I23Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Collagen V (COL5A1) Human Gene Knockout Kit (CRISPR)
KN212443RB 1 Kit

Collagen V (COL5A1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details