TMEM177 Peptide - C-terminal region
TMEM177 Peptide - C-terminal region
Product Specifications
UniProt
Q53S58
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TMEM177 Rabbit Polyclonal Antibody (orb327127) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_085054
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AYACGGVEFYEKLLSGNLALRSLLGKDGEKLYTPSGNIVPRHLFRIKHLP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC401469-100 1x 100 µL
MCM7 (Proliferation Marker) (MCM7/1469), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TP322271M 100 µg
Hemopexin (HPX) (NM_000613) Human Recombinant Protein
Sign In for Pricing
View Details 