ZNF735 Peptide - middle region
ZNF735 Peptide - middle region
Product Specifications
UniProt
P0CB33
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF735 Rabbit Polyclonal Antibody (orb587811) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001152996
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NLFSLGMTVSKPDLIACLEQNKEPQNIKRNEMAAKHPVTCSHFNQDLQPE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1882058-01 0.01 mg
Biotinylated Anti-Galectin 9 antibody (DMC279); IgG1 Chimeric mAb
Sign In for Pricing
View Details MBS1882058-02 0.1 mg
Biotinylated Anti-Galectin 9 antibody (DMC279); IgG1 Chimeric mAb
Sign In for Pricing
View Details MBS1882058-03 0.5 mg
Biotinylated Anti-Galectin 9 antibody (DMC279); IgG1 Chimeric mAb
Sign In for Pricing
View Details MBS1882058-04 5x 0.5 mg
Biotinylated Anti-Galectin 9 antibody (DMC279); IgG1 Chimeric mAb
Sign In for Pricing
View Details 
MBS2073889-01 0.1 mL
Cy3-Linked Polyclonal Antibody to Protocadherin Beta 15 (PCDHb15)
Sign In for Pricing
View Details