ZNF735 Peptide - middle region
ZNF735 Peptide - middle region
Product Specifications
UniProt
P0CB33
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ZNF735 Rabbit Polyclonal Antibody (orb587811) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001152996
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NLFSLGMTVSKPDLIACLEQNKEPQNIKRNEMAAKHPVTCSHFNQDLQPE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
244145 100 µg
CACNB2 (Calcium Channel, Voltage-Dependent, beta 2 Subunit, CACNLB2, CAVB2, FLJ23743, MYSB)
Sign In for Pricing
View Details 
BML-PW8900-0001 8x 10 μL
Proteasome 20S (alpha subunits) antibody sampler pack
Sign In for Pricing
View Details