Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHISA9 Peptide - middle region

SHISA9 Peptide - middle region

Product Specifications

UniProt

H0YNH4

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SHISA9 Rabbit Polyclonal Antibody (orb587815) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NYDTPLWLNTGKPPARKDDPLHDPTKDKTNLIVYIICGVVAVMVLVGIFT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C1orf93 (FAM213B) activation kit by CRISPRa
GA114990 1 Kit

Human C1orf93 (FAM213B) activation kit by CRISPRa

Sign In for Pricing
View Details
WASP Recombinant Rabbit Monoclonal Antibody [JE36-82]
HA721659 100 µL

WASP Recombinant Rabbit Monoclonal Antibody [JE36-82]

Sign In for Pricing
View Details
Twist1 Mouse Gene Knockout Kit (CRISPR)
KN318498LP 1 Kit

Twist1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Low Density Lipoprotein Receptor Related Protein 5 (LRP5) ELISA Kit
RD-LRP5-Mu-01 96 Tests

Mouse Low Density Lipoprotein Receptor Related Protein 5 (LRP5) ELISA Kit

Sign In for Pricing
View Details
Mouse Low Density Lipoprotein Receptor Related Protein 5 (LRP5) ELISA Kit
RD-LRP5-Mu-02 48 Tests

Mouse Low Density Lipoprotein Receptor Related Protein 5 (LRP5) ELISA Kit

Sign In for Pricing
View Details
NUDT18 (NM_024815) Human Over-expression Lysate
LY403033 100 µg

NUDT18 (NM_024815) Human Over-expression Lysate

Sign In for Pricing
View Details