Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SHISA9 Peptide - middle region

SHISA9 Peptide - middle region

Product Specifications

UniProt

H0YNH4

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SHISA9 Rabbit Polyclonal Antibody (orb587815) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NYDTPLWLNTGKPPARKDDPLHDPTKDKTNLIVYIICGVVAVMVLVGIFT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4,4-Diethoxy-N,N-diethyl-1-butanamine
TRC-D168970-25MG 25 mg

4,4-Diethoxy-N,N-diethyl-1-butanamine

Sign In for Pricing
View Details
GATA-3 (Breast and Urothelial Marker) (GATA3/2445), CF740 conjugate, 0.1mg/mL
BNC742445-100 1x 100 µL

GATA-3 (Breast and Urothelial Marker) (GATA3/2445), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant BIG-2 Antibody
RC-16510-01 50 μL

Recombinant BIG-2 Antibody

Sign In for Pricing
View Details
Recombinant BIG-2 Antibody
RC-16510-02 100 µL

Recombinant BIG-2 Antibody

Sign In for Pricing
View Details
Recombinant BIG-2 Antibody
RC-16510-03 1 mL

Recombinant BIG-2 Antibody

Sign In for Pricing
View Details
CD73 Polyclonal Antibody
E-AB-14725-01 20 µL

CD73 Polyclonal Antibody

Sign In for Pricing
View Details