Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATF1 Peptide - N-terminal region

ATF1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

EWS-ATF1, FUS/ATF-1, TREB36

UniProt

P18846

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATF1 Rabbit Polyclonal Antibody (orb573768) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005162

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DLSSEDTRGRKGDGENSGVSAAVTSMSVPTPIYQTSSGQYIAIAPNGALQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosine Hydroxylase (TH) Mouse Monoclonal Antibody [Clone ID: LBI3A7]
AMM13870VCF 100 µg

Tyrosine Hydroxylase (TH) Mouse Monoclonal Antibody [Clone ID: LBI3A7]

Sign In for Pricing
View Details
Anti-African clawed frog poly-Ig Receptor-2 Antibody, PE Conjugate
DZ41067-PE 200 µL/Vial

Anti-African clawed frog poly-Ig Receptor-2 Antibody, PE Conjugate

Sign In for Pricing
View Details
Carnitine Palmitoyltransferase 1A, Liver (CPT1A) BioAssayTM ELISA Kit (Human) (Wide Range)
517068 96 Tests

Carnitine Palmitoyltransferase 1A, Liver (CPT1A) BioAssayTM ELISA Kit (Human) (Wide Range)

Sign In for Pricing
View Details
PKN2 Rabbit mAb
MBS9468255-01 0.05 mL

PKN2 Rabbit mAb

Sign In for Pricing
View Details
PKN2 Rabbit mAb
MBS9468255-02 0.1 mL

PKN2 Rabbit mAb

Sign In for Pricing
View Details
PKN2 Rabbit mAb
MBS9468255-03 5x 0.1 mL

PKN2 Rabbit mAb

Sign In for Pricing
View Details