Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATF1 Peptide - N-terminal region

ATF1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

EWS-ATF1, FUS/ATF-1, TREB36

UniProt

P18846

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATF1 Rabbit Polyclonal Antibody (orb573768) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005162

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DLSSEDTRGRKGDGENSGVSAAVTSMSVPTPIYQTSSGQYIAIAPNGALQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Speedy protein E10 (SPD10)
orb3009129-01 20 µg

Recombinant Human Speedy protein E10 (SPD10)

Sign In for Pricing
View Details
Recombinant Human Speedy protein E10 (SPD10)
orb3009129-02 100 µg

Recombinant Human Speedy protein E10 (SPD10)

Sign In for Pricing
View Details
Recombinant Human Speedy protein E10 (SPD10)
orb3009129-03 1 mg

Recombinant Human Speedy protein E10 (SPD10)

Sign In for Pricing
View Details
LRRC9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
27706111 3x 1.0 µg

LRRC9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Rabbit Anti-Human FOXO1 (aa 317-321) Polyclonal Antibody
CPB-1059RH 100 ul

Rabbit Anti-Human FOXO1 (aa 317-321) Polyclonal Antibody

Sign In for Pricing
View Details
EDA Rabbit pAb
A2905-01 20 µL

EDA Rabbit pAb

Sign In for Pricing
View Details