Cnot3 Peptide - middle region
Cnot3 Peptide - middle region
Product Specifications
UniProt
D3ZUV9
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Cnot3 Rabbit Polyclonal Antibody (orb575033) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: CTTENSEDDKKRGRSTDSEVSQSPAKNGSKPVHSNQHPQSPAVPPTYPSG
More Discoveries
Explore Other Products
Browse additional items from our catalog
RC215119L4 10 µg
FAM120AOS (NM_198841) Human Tagged Lenti ORF Clone
Sign In for Pricing
View Details 
GTR15368262 1 Vial
Lentiviral human DISP1 sgRNA gene knockout kit - Lentiviral human DISP1 sgRNA gene knockout kit (25)
Sign In for Pricing
View Details