Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BANP Peptide - N-terminal region

BANP Peptide - N-terminal region

Product Specifications

UniProt

D3DUN6

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BANP Rabbit Polyclonal Antibody (orb575242) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VVQIAVEDLSPDHPVVLENHVVTDEDEPALKRQRLEINCQDPSIKSFLYS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD61 Polyclonal Antibody
E-AB-14160-01 20 µL

CD61 Polyclonal Antibody

Sign In for Pricing
View Details
CD61 Polyclonal Antibody
E-AB-14160-02 60 µL

CD61 Polyclonal Antibody

Sign In for Pricing
View Details
CD61 Polyclonal Antibody
E-AB-14160-03 120 µL

CD61 Polyclonal Antibody

Sign In for Pricing
View Details
CD61 Polyclonal Antibody
E-AB-14160-04 200 µL

CD61 Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: rectosigmoid
CS625505 5x 5 µm

Frozen Tissue Sections, Colon: rectosigmoid

Sign In for Pricing
View Details
N-(4-Bromophenyl)-[1,1-biphenyl]-4-amine
TRC-B678643-500MG 500 mg

N-(4-Bromophenyl)-[1,1-biphenyl]-4-amine

Sign In for Pricing
View Details